Follistatin 344 – 1mg

Follistatin 344 is a recombinant, high-purity peptide widely studied for its role in inhibiting myostatin—a negative regulator of muscle growth. As a result, it has gained strong interest in scientific research focused on skeletal muscle hypertrophy, injury recovery, and age-related muscle wasting (sarcopenia).

Derived from the full-length human sequence, Follistatin 344 functions as a binding protein within the TGF-β superfamily, neutralising not only myostatin, but also activin A, and other regulatory peptides. Its indirect pathway—bypassing the androgen receptor—makes it a compelling target for research into non-hormonal muscle enhancement.

---

Key Research Applications

Follistatin 344 has been studied across various biological systems for its potential to:

• Increase lean muscle mass without hormonal stimulation

• Enhance muscle fibre regeneration following injury or surgical trauma

• Reduce inflammation via modulation of cytokine activity

• Support connective tissue and tendon recovery

• Counteract catabolic muscle loss in disease models

• Modulate fertility and reproductive signalling pathways

Its effectiveness as a myostatin inhibitor positions Follistatin 344 at the centre of regenerative biology and muscle therapeutics research.

---

Mechanism of Action

Follistatin 344 acts by binding and neutralising circulating levels of myostatin and related proteins such as activin A, preventing their interaction with ActRIIB receptors. This reduces the downstream signalling responsible for inhibiting muscle development. Additionally, Follistatin has shown potential to influence follliculogenesis, cell differentiation, and immune regulation, highlighting its broad research relevance.

Follistatin 344
CAS Number	116986-95-1
Molar Mass	38.5 kDa (as a glycoprotein)
Molecular Formula	Variable (depending on isoform and glycosylation)
Sequence	344 amino acids………..Sequence (Human Follistatin 344): MPLPWLGLFLGLGLGNSGQEVHHHGDWASWSETRGRDLQIEVYAGYKEGDLAVFHSKVHLRKRLEVVLNQNAQFLLDLEVKVETIKTDIHFDDGSSPGYAEGTEDEYIFLRVFYQDLRNHQGQALVRSMMLGRCQVSLNLKPQKSFYNDIKKVLNMEQNQAEFLVSYNLLSYSGKRPGSSTGGRSLTLCINSTQVKHEAEQCFDRYSDQCPKRTCTCQDGEDTICKTDSCENECREPDGQCHCRALDCLCGDGLDTCVCSEYGSQHCEACPDSKACCVGDKVCCLRACCVPPPVLHLVNAIYFKGNKQCRPVRTNSEIDIQLIHLYYAKRALESGPATWATAAMLGGPGSGGGGGPGAPGEAAAAAAAEAEA

  Important Reminder:
Before reconstitution, ensure both the peptide and bacteriostatic mixing water are at room temperature to support proper dissolution and avoid destabilising the compound.
Bacteriostatic mixing water sold separately.

Disclaimer

  All products featured on this site are intended solely for research purposes and are not for human or animal consumption under any circumstances. These items should not be classified as drugs, foods, cosmetics, or medicinal products. By purchasing, the buyer assumes all associated risks and agrees to handle the products only as specified. Products should be administered by qualified professionals with the relevant expertise. The distributor, manufacturer, and seller bear no responsibility for any misuse or subsequent outcomes arising from the use of these products. By completing and paying for your order, you agree to our Terms and Conditions and acknowledge that you will abide by these terms.