on side png  - 1

Follistatin – 344 Ready-to-Use Peptide Pens and Cartridges 1mg

106,99 314,97 

Follistatin 344 – 1mg

Follistatin 344 is a recombinant, high-purity peptide widely studied for its role in inhibiting myostatin—a negative regulator of muscle growth. As a result, it has gained strong interest in scientific research focused on skeletal muscle hypertrophy, injury recovery, and age-related muscle wasting (sarcopenia).

Derived from the full-length human sequence, Follistatin 344 functions as a binding protein within the TGF-β superfamily, neutralising not only myostatin, but also activin A, and other regulatory peptides. Its indirect pathway—bypassing the androgen receptor—makes it a compelling target for research into non-hormonal muscle enhancement.


Key Research Applications

Follistatin 344 has been studied across various biological systems for its potential to:

  • Increase lean muscle mass without hormonal stimulation

  • Enhance muscle fibre regeneration following injury or surgical trauma

  • Reduce inflammation via modulation of cytokine activity

  • Support connective tissue and tendon recovery

  • Counteract catabolic muscle loss in disease models

  • Modulate fertility and reproductive signalling pathways

Its effectiveness as a myostatin inhibitor positions Follistatin 344 at the centre of regenerative biology and muscle therapeutics research.


Mechanism of Action

Follistatin 344 acts by binding and neutralising circulating levels of myostatin and related proteins such as activin A, preventing their interaction with ActRIIB receptors. This reduces the downstream signalling responsible for inhibiting muscle development. Additionally, Follistatin has shown potential to influence follliculogenesis, cell differentiation, and immune regulation, highlighting its broad research relevance.

Follistatin 344
CAS Number 116986-95-1
Molar Mass 38.5 kDa (as a glycoprotein)
Molecular Formula Variable (depending on isoform and glycosylation)
Sequence 344 amino acids………..Sequence (Human Follistatin 344):
MPLPWLGLFLGLGLGNSGQEVHHHGDWASWSETRGRDLQIEVYAGYKEGDLAVFHSKVHLRKRLEVVLNQNAQFLLDLEVKVETIKTDIHFDDGSSPGYAEGTEDEYIFLRVFYQDLRNHQGQALVRSMMLGRCQVSLNLKPQKSFYNDIKKVLNMEQNQAEFLVSYNLLSYSGKRPGSSTGGRSLTLCINSTQVKHEAEQCFDRYSDQCPKRTCTCQDGEDTICKTDSCENECREPDGQCHCRALDCLCGDGLDTCVCSEYGSQHCEACPDSKACCVGDKVCCLRACCVPPPVLHLVNAIYFKGNKQCRPVRTNSEIDIQLIHLYYAKRALESGPATWATAAMLGGPGSGGGGGPGAPGEAAAAAAAEAEA
  Important Reminder:
Before reconstitution, ensure both the peptide and bacteriostatic mixing water are at room temperature to support proper dissolution and avoid destabilising the compound.
Bacteriostatic mixing water sold separately.

Disclaimer

  All products featured on this site are intended solely for research purposes and are not for human or animal consumption under any circumstances. These items should not be classified as drugs, foods, cosmetics, or medicinal products. By purchasing, the buyer assumes all associated risks and agrees to handle the products only as specified. Products should be administered by qualified professionals with the relevant expertise. The distributor, manufacturer, and seller bear no responsibility for any misuse or subsequent outcomes arising from the use of these products. By completing and paying for your order, you agree to our Terms and Conditions and acknowledge that you will abide by these terms.

Choose Between Pre-Mixed and Lyophilised Peptides for Your Research

We offer two premium peptide formats to suit your research needs:


1. Pre-Mixed Cartridges (Ready to Use)

Pre-Mixed with Bacteriostatic Water:
Each cartridge is professionally reconstituted using sterile bacteriostatic water to optimise peptide stability, maintain sterility, and ensure safe, effective delivery.

Ready for Immediate Use:
No mixing required—simply load into your pen and begin.

Effortless & Convenient:
Perfect for users who want quick, straightforward administration with zero preparation time.

Cold Shipping Required:
To preserve product quality, pre-mixed peptides are shipped using cold-chain logistics.

Use Within 30 Days (Refrigerated):
Pre-mixed peptides remain effective for up to 30 days when stored in a refrigerated environment (2–8°C) after reconstitution.

Exclusive Offer – Thermal Containers:
Protect your peptides during shipping and storage with a medical-grade thermal insulin container.
Special price: €49.99 (normally €59.99) when selected at checkout with Express Ice Shipping.


2. Lyophilised Cartridges (Ready to Mix)

Custom Preparation:
Each cartridge contains your lyophilised peptide, ready for reconstitution with bacteriostatic water just before use.

No Cold Shipping Required:
These cartridges can be shipped without refrigeration, making delivery more cost-effective and flexible.

Stable Before and After Reconstitution:
Lyophilised peptides are highly stable in their dry form, allowing for longer storage before mixing. Once reconstituted with bacteriostatic water and stored in the fridge, they typically remain effective for up to 30 days.

Precise Dosing with Pen Delivery:
After reconstitution, the pen system ensures consistent, accurate administration.

Portable & Discreet:
Compact format ideal for research, travel, or daily use.


Available Formats: Single 1, 2 & 3 Cartridges

Choose from both formats:

  • Pre-Mixed: Ready to use, reconstituted with bacteriostatic water.

  • Lyophilised: Comes with lyophilised peptide (bacteriostatic water sold separately).

Note: Pens are not included with individual cartridge purchases.


Which Format Is Right for You?

  • Pre-Mixed Cartridges: Best for those who value speed and simplicity. Professionally prepared with bacteriostatic water and shipped cold to maintain quality. Effective for up to 30 days when stored in the fridge.

  • Lyophilised Cartridges: Offer shipping flexibility, long shelf life before mixing, and up to 30 days of usability after reconstitution if refrigerated. You’ll need to reconstitute the peptide with bacteriostatic water, sold separately.


Key Features – Both Formats

  • Sterile, Stable, and Safe: Trusted solutions for precision research.

  • User-Friendly: Clear markers and easy cartridge handling.

  • Compact Design: Lightweight and discreet—ideal for daily or travel use.

  • Tailored for You: Choose convenience or flexibility based on your preference and storage needs.


Quality Peptides. Flexible Formats. Your Choice.

Whether you prefer the simplicity of pre-mixed cartridges or the storage flexibility of lyophilised peptides, both formats offer premium performance—now with clear guidance to support your research every step of the way.


Don’t Forget:

Bacteriostatic water is not included with lyophilised cartridges.
You’ll need to purchase it separately to safely and effectively prepare your peptide solution.

Disclaimer: All products featured on this site are intended solely for research purposes and are not for human or animal consumption under any circumstances. These items should not be classified as drugs, foods, cosmetics, or medicinal products. By purchasing, the buyer assumes all associated risks and agrees to handle the products only as specified. Products should be administered by qualified professionals with the relevant expertise. The distributor, manufacturer, and seller bear no responsibility for any misuse or subsequent outcomes arising from the use of these products. By completing and paying for your order, you agree to our Terms and Conditions and acknowledge that you will abide by these terms.
SKU Follistatin - 344 Ready-to-Use Peptide Pens and Cartridges 1mg Category

ALL PRODUCT INFORMATION AND ARTICLES ON THIS SITE ARE FOR EDUCATIONAL PURPOSES ONLY

DISCLAIMER: Products from Research Peptides Europe are intended for research and laboratory use only and are not for human or animal consumption. These items should not be classified as drugs, foods, cosmetics, or medicinal products. By purchasing, the buyer assumes the associated risks. Handling should be limited to qualified professionals.

 

Options

Full Reusable Pen Kit with 1 Pre Mixed cartridge 1mg, Full Reusable Pen Kit with 1 Lyophilized 1mg, Full Disposable Pen Kit with 1 Pre Mixed cartridge 1mg, Full Disposable Pen Kit with 1 Lyophilized cartridge 10mg, Full Disposable Pen Kit with 1 Lyophilized Cartridge 10mg, 1 Pre Mixed Cartridge 1mg, 2 Pre Mixed Cartridges 1mg, 3 Pre Mixed Cartridges 1mg, 1 Lyophilized Cartridge 1mg, 2 Lyophilized Cartridges 1mg, 3 Lyophilized Cartridges 1mg

Related Product

Shopping Basket
Translate »