Follistatin -344 1mg
99.99 €
Follistatin 344 – 1mg
Follistatin 344 is a recombinant, high-purity peptide widely studied for its role in inhibiting myostatin—a negative regulator of muscle growth. As a result, it has gained strong interest in scientific research focused on skeletal muscle hypertrophy, injury recovery, and age-related muscle wasting (sarcopenia).
Derived from the full-length human sequence, Follistatin 344 functions as a binding protein within the TGF-β superfamily, neutralising not only myostatin, but also activin A, and other regulatory peptides. Its indirect pathway—bypassing the androgen receptor—makes it a compelling target for research into non-hormonal muscle enhancement.
Key Research Applications
Follistatin 344 has been studied across various biological systems for its potential to:
-
Increase lean muscle mass without hormonal stimulation
-
Enhance muscle fibre regeneration following injury or surgical trauma
-
Reduce inflammation via modulation of cytokine activity
-
Support connective tissue and tendon recovery
-
Counteract catabolic muscle loss in disease models
-
Modulate fertility and reproductive signalling pathways
Its effectiveness as a myostatin inhibitor positions Follistatin 344 at the centre of regenerative biology and muscle therapeutics research.
Mechanism of Action
Follistatin 344 acts by binding and neutralising circulating levels of myostatin and related proteins such as activin A, preventing their interaction with ActRIIB receptors. This reduces the downstream signalling responsible for inhibiting muscle development. Additionally, Follistatin has shown potential to influence follliculogenesis, cell differentiation, and immune regulation, highlighting its broad research relevance.
Follistatin 344 |
|
CAS Number | 116986-95-1 |
Molar Mass | 38.5 kDa (as a glycoprotein) |
Molecular Formula | Variable (depending on isoform and glycosylation) |
Sequence | 344 amino acids………..Sequence (Human Follistatin 344):MPLPWLGLFLGLGLGNSGQEVHHHGDWASWSETRGRDLQIEVYAGYKEGDLAVFHSKVHLRKRLEVVLNQNAQFLLDLEVKVETIKTDIHFDDGSSPGYAEGTEDEYIFLRVFYQDLRNHQGQALVRSMMLGRCQVSLNLKPQKSFYNDIKKVLNMEQNQAEFLVSYNLLSYSGKRPGSSTGGRSLTLCINSTQVKHEAEQCFDRYSDQCPKRTCTCQDGEDTICKTDSCENECREPDGQCHCRALDCLCGDGLDTCVCSEYGSQHCEACPDSKACCVGDKVCCLRACCVPPPVLHLVNAIYFKGNKQCRPVRTNSEIDIQLIHLYYAKRALESGPATWATAAMLGGPGSGGGGGPGAPGEAAAAAAAEAEA |
Before reconstitution, ensure both the peptide and bacteriostatic mixing water are at room temperature to support proper dissolution and avoid destabilising the compound.
Bacteriostatic mixing water sold separately.
Reviews
There are no reviews yet.